PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_33399_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 188aa    MW: 21574.3 Da    PI: 7.1441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_33399_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
   Neem_33399_f_1 15 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding55.51.3e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ d+++++G++ W++Ia++++ gRt++++k++w++
   Neem_33399_f_1  68 RGNITPEEQLLIMDLHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-25765IPR009057Homeodomain-like
PROSITE profilePS5129416.0641062IPR017930Myb domain
SuperFamilySSF466893.39E-3013109IPR009057Homeodomain-like
SMARTSM007177.2E-131464IPR001005SANT/Myb domain
PfamPF002492.2E-161562IPR001005SANT/Myb domain
CDDcd001673.55E-101762No hitNo description
PROSITE profilePS5129425.12963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2566117IPR009057Homeodomain-like
SMARTSM007172.5E-1567115IPR001005SANT/Myb domain
PfamPF002494.2E-1668111IPR001005SANT/Myb domain
CDDcd001677.57E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MDKAPCNSQD AEVRKGPWTM EEDLILINYI ANHGEGVWNS LAKAAGLKRT GKSCRLRWLN  60
YLRPDVKRGN ITPEEQLLIM DLHAKWGNRW SKIAKHLPGR TDNEIKNFWR TRIQKHIKQA  120
ETLSGHSSEA NEQASSSQMS TAAYTMEAYS PPSYQANMDH QTFPMAPLPT EVNENYWTME  180
DLWLLNGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261011722128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006470308.11e-123PREDICTED: myb-related protein 305
SwissprotP813912e-96MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A067FJ191e-122A0A067FJ19_CITSI; Uncharacterized protein
STRINGVIT_14s0066g01090.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-82myb domain protein 21